Protein Info for mRNA_3853 in Rhodosporidium toruloides IFO0880

Name: 12221
Annotation: K08193 SLC17A MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), other

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details amino acids 432 to 455 (24 residues), see Phobius details PF07690: MFS_1" amino acids 52 to 418 (367 residues), 112.7 bits, see alignment E=9.8e-37

Best Hits

KEGG orthology group: None (inferred from 55% identity to cne:CND04690)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>mRNA_3853 K08193 SLC17A MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), other (Rhodosporidium toruloides IFO0880)
MSSPSLHSSDKEKGQEIHNEYVGKALDAPYLSPAEEKKLMRKIDYKLVPFLSLLYLLSFL
DRVNIGQARLDGLEKDLHLKGNQYQIALVVFFVGYVSTEIPGNILLKKMRPSRFIPAIMI
SWGIVMTLMGTCSNFAGLVAARFFLGLTESVLFPGICFYLVSWYKRNESNLRIAIFFSSA
TLSGAFGGLLAYGLSKMAGVGGKGGWAWIFIIEGLLTFVVGCISPWMIEDFPEEAQFLTP
AEREHVVRRLKEDTGAAGTFKMKYVMDAFKDWKTYVFALIYIGVAEPLYALSLFSPTIIS
ELGTFSRAQSQLLSTPPYALAFFITLATAIYSDRIQRRGIFNIFWMTVVIIGYGILIGIE
TQKHPGVAYFAVFLCVCGVAPCIANTIVWTGNNFSGVLKRGTSMGVMFAVGNSGGIVSSL
VYRTQDKPRYILGHAVGLGFAGMCVLLSIFMMVYFQRENARRDAKYGKVPDFVLGANGEE
LTSVADDPEIRRRFGLDGMTEEQIEGLGDKNPLFRYYQ