Protein Info for mRNA_3875 in Rhodosporidium toruloides IFO0880

Name: 12243
Annotation: KOG2614 Kynurenine 3-monooxygenase and related flavoprotein monooxygenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF01494: FAD_binding_3" amino acids 9 to 386 (378 residues), 48.9 bits, see alignment E=6.2e-17 PF13450: NAD_binding_8" amino acids 13 to 45 (33 residues), 22.6 bits, see alignment (E = 1e-08)

Best Hits

KEGG orthology group: K00480, salicylate hydroxylase [EC: 1.14.13.1] (inferred from 78% identity to cnb:CNBA8030)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.1

Use Curated BLAST to search for 1.14.13.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>mRNA_3875 KOG2614 Kynurenine 3-monooxygenase and related flavoprotein monooxygenases (Rhodosporidium toruloides IFO0880)
MAPALANELKIHIIGAGMGGMGSALALARAGYTDIHVWESARSLGEVGAGINLTPNLSRI
LDRWEVLDIAKAEAVALKSASVLNCASDETLTNVDFGYIEREFGYPFTVVHRSALQKCLV
TGAMGSGVVQLHLNKLVTDYDFEGSRFFVKERSSTPTNGANGDTEASTEHAGEWVQADVI
LAADGVKSKARAAMLGRKGEVDTVVDTGQAAYRIMVRKEQINNDPDLLPFFTSSHSFRWI
GEKRHIIAYPIASGEIFNMSTAHPDRRFVEADTWTATGSKSEMLNTFHDFCPRVQKLLNL
VPEGDVLEWKLRVHEPLSTWVDHNVALVGDACHPTLPHLAQGAAQAIEDAAVLGVVLSKI
KSKDEIHKALLVYQAIRKPRADWAVMTAAANGKGLHLGAGKDQEARDAAFRTAKKEGGEN
PDKALDKITQEILYAHDCEVEAANAFEKLFAEVA