Protein Info for mRNA_3876 in Rhodosporidium toruloides IFO0880

Name: 12244
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 93 to 110 (18 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 278 to 284 (7 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 390 to 416 (27 residues), see Phobius details amino acids 428 to 446 (19 residues), see Phobius details amino acids 457 to 478 (22 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 441 (408 residues), 111.2 bits, see alignment E=5.5e-36 PF00083: Sugar_tr" amino acids 69 to 251 (183 residues), 55 bits, see alignment E=7e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>mRNA_3876 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MFRNHVDPSLPPNHPVNSLSSLRKFLILLTLSYSGFLANFSVAIIQVAFVPMGKAFGVSP
GDIPNTIGYNLLGFAVGPLLWNPLSKTIGRRPVYLIGSALFLPCVVWMALSPSYACFSAA
RTVAGIVSSFSQTVPPATVADIFVKEVRGSKMSMYAVAVVIAPAVAPVFSGLIVNSQPWH
VLFWFILGLAGLQLALFAVIVPETLWNEESTSNSVDKHNSLNDSIADAGEKAAFDEQQIE
TVDNTASVNSRAGRVGAAWMPWQRPGEFFRIFVSPFLMARYIAISLPSIYYGMVFAWSVS
ITIVAPQMFEKPPYNFKTIPVGASFLAYGIGGVLGKWSGGIVGDKVVAHFERKKGSRQPE
DRLWALLPILPFMMVACAIVAVVIRDQLPWIAYLIGGALFFFCLSAATGILQTYVLESFL
PRSTDGQAVFIFLKSIWGFAIPFILTSLETSTGYFKGYMMMGALATGVGFLLCGGLIWKG
YEVRKGQGMPVVAR