Protein Info for mRNA_3891 in Rhodosporidium toruloides IFO0880

Name: 12259
Annotation: K07889 RAB5C Ras-related protein Rab-5C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00025: Arf
  • amino acids 17 to 137 (121 residues), 57.7 bits, E=2.8e-19
• TIGR00231: small GTP-binding protein domain
  • amino acids 18 to 138 (121 residues), 86.8 bits, E=6.9e-29
• PF00071: Ras
  • amino acids 19 to 229 (211 residues), 191.9 bits, E=1.5e-60
• PF08477: Roc
  • amino acids 19 to 134 (116 residues), 120.8 bits, E=1e-38
• PF04670: Gtr1_RagA
  • amino acids 19 to 139 (121 residues), 26.8 bits, E=8.3e-10
• PF01926: MMR_HSR1
  • amino acids 20 to 126 (107 residues), 24.4 bits, E=6.6e-09

Best Hits

KEGG orthology group: K07976, Rab family, other (inferred from 64% identity to lbc:LACBIDRAFT_300799)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• ethylene glycol degradation (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• mitochondrial NADPH production (yeast) (2/5 steps found)
• octane oxidation (2/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• D-arabinose degradation I (1/4 steps found)
• putrescine degradation III (1/4 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• dopamine degradation (1/5 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• limonene degradation IV (anaerobic) (2/7 steps found)
• superpathway of glycol metabolism and degradation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• aromatic biogenic amine degradation (bacteria) (2/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (6/16 steps found)
• superpathway of pentose and pentitol degradation (6/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Protein Sequence (274 amino acids)

>mRNA_3891 K07889 RAB5C Ras-related protein Rab-5C (Rhodosporidium toruloides IFO0880)
MATPAAAAEQPPARPVQVKLVLLGESAVGKSSVVLRFCQNDFQPNKEPTIGAAFLTQRCR
LEDKVIKFEIWDTAGQERFRSLSPMYYRNAQAAVVVYDVTKSASLEQAKTWVKELQRQAN
PNIVIALAGNKVDLVRPSSDGDDSASDAAVNPEDSEEADDATATPEDEAGSAAGDDEGPD
GGKPSESRRQVSREEAEEYAKECGLLFFETSAKTGEGVVEVFTEIAKKIPLDALIAQSRG
PGGANRGAGRGGGGANSSVNLSENEADKKDACAC