Protein Info for mRNA_3908 in Rhodosporidium toruloides IFO0880

Name: 12276
Annotation: Interpro Protein of unknown function (DUF2945)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF11160: Hva1_TUDOR" amino acids 75 to 137 (63 residues), 60.9 bits, see alignment E=5.5e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>mRNA_3908 Interpro Protein of unknown function (DUF2945) (Rhodosporidium toruloides IFO0880)
MRSDDPRPRFARLTPVCSPRASPLLLGRRYLLLASPHLTAPSQDCSSTNATPGEGFSSIK
RRKDIMTKPEDLKEGDRVSWNYGGGHPTGTVEAVVPEHDTIETKGGKEVSRKGTAEDPAV
ELKADSGNKAIKLAHELNEVDESSTGDKTSYAKEAAGGDAKTNKEAEEKTGDKDVGEDKS
EERKEESEEKDEGKDDAKEAQRKGGQKGGKASGKSKAPAAKKQKTK