Protein Info for mRNA_3918 in Rhodosporidium toruloides IFO0880

Name: 12286
Annotation: KOG0024 Sorbitol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF08240: ADH_N" amino acids 67 to 194 (128 residues), 86.4 bits, see alignment E=6e-29

Best Hits

KEGG orthology group: None (inferred from 51% identity to fgr:FG02432.1)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>mRNA_3918 KOG0024 Sorbitol dehydrogenase (Rhodosporidium toruloides IFO0880)
MAMNAAANTLENNMQSPPTGIQAGIANPSLQKEGADSSGDKMKALVWEGKMKVKVEEALK
PKVVDAKDIVIKVTGSTVCGSDMHLLAGAIIELRKGDILGHECMGIVDSVGPGVTKLKVG
DRVVAGFNIGCGECFMCQKKLSSACQMTNDSALMNTMYGGRTCGMLGYSHFTGGFAGGQA
EFVRIPYGDANCVKVPEGVYDEDALYISDSLVTSFHQVEDTRVDEGDIVGIWGVGVIGLL
VGKWSILRGASRLIAVDSVQWRLDYFKEKLLKDHPNVQIDLVNFSEHKNVVARIHELTKA
GTRGLPDTRPDGLDVAFECAAGEYAKSWAHKLEMVAGLETDTSEILNEMIESTIGFGRVG
ITGVYAGYTNHFNVGSLMQRGIRFIGNGQAPTHKYMDRVMNDYIATGKVKPRELFVTHRV
PIEDIDKVYYHMREHSEKTKIIKAFVATAASAPPAPGAPPLTRIE