Protein Info for mRNA_3955 in Rhodosporidium toruloides IFO0880

Name: 12323
Annotation: K02355 fusA, GFM, EFG elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00484: translation elongation factor G" amino acids 79 to 780 (702 residues), 878.3 bits, see alignment E=3.3e-268 PF00009: GTP_EFTU" amino acids 83 to 367 (285 residues), 197.2 bits, see alignment E=5.3e-62 TIGR00231: small GTP-binding protein domain" amino acids 84 to 267 (184 residues), 88.8 bits, see alignment E=3.5e-29 PF03144: GTP_EFTU_D2" amino acids 410 to 475 (66 residues), 50.5 bits, see alignment E=5.5e-17 PF14492: EFG_II" amino acids 491 to 563 (73 residues), 101.6 bits, see alignment E=5e-33 PF03764: EFG_IV" amino acids 565 to 687 (123 residues), 126.4 bits, see alignment E=1.3e-40 PF00679: EFG_C" amino acids 691 to 776 (86 residues), 83.1 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 70% identical to EFGM_CRYNJ: Elongation factor G, mitochondrial (MEF1) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K02355, elongation factor G (inferred from 70% identity to cne:CNC01520)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (789 amino acids)

>mRNA_3955 K02355 fusA, GFM, EFG elongation factor G (Rhodosporidium toruloides IFO0880)
MLRSAASSLRAQLPRASRSLAPSRTVAARSLAAQSTRTPRFALQRRSFAASALRSDEEGK
PQPVQPLAAKFPLSDEDRTRLTRLRNVGISAHIDSGKTTLTERILFYTGRVASIHEVRGR
DGVGAKMDSMELEREKGITIQSAATFADWEVKQAADKEKEGKYSINIIDTPGHVDFTIEV
ERALRVLDGAVLVLCAVSGVQSQTITVDRQMRRYNVPRLSFINKMDRAGANPERVLNQIR
QKLRMKAAMVTMPMGAEADFAGVVDLVQMKAVFNEGEKGITVRQGEIPAEYVEAAKAKRA
ELVETLAEVDDEIADAWLEEREITPVEMANAVRRATIALKFTPVFTGSALANKSVQPVLD
GVCLYLPTPNEVPAVATNMEAPQDPPQTLSPTSKAPLVSLAFKLEEGRYGQLTYIRVYQG
TLKKGAVITNVRTGKKVKVPRLVRMHSDEMEDVDSIGAGEICAMFGVECSSGDTFSDQPG
GGGFTMTQMFVPEPVISLAIRPKGQETPNFSRALNRFQKEDPTFRVHVDAESQETIISGM
GELHLDIYVERMRREYNTECITGKPRVAFRETITQAVPFNYTHKKQSGGAGQYGKVVGRL
EPMELDPETGKDTAFESVVIGGNIPSGYIPAVQKGFNDALERGILTGHQICGVKMVLEDG
AAHQVDSSELAFRLAAQGAFREAFPKAAPVVLEPIMKVEIIAPAEFQGNVIGGINQRMGS
IVDTEVRDEEFTVICEVPLNAMFGYASQLRGMTQGKGEFSMEYLRHAAVQPGVQKEMEAA
HRAFIGRKS