Protein Info for mRNA_3985 in Rhodosporidium toruloides IFO0880

Name: 12353
Annotation: K03448 FEN2, LIZ1 MFS transporter, ACS family, pantothenate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 332 to 350 (19 residues), see Phobius details amino acids 357 to 380 (24 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 403 (368 residues), 110 bits, see alignment E=6.2e-36

Best Hits

KEGG orthology group: K03448, MFS transporter, ACS family, pantothenate transporter (inferred from 48% identity to dha:DEHA2C13816g)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>mRNA_3985 K03448 FEN2, LIZ1 MFS transporter, ACS family, pantothenate transporter (Rhodosporidium toruloides IFO0880)
MRFWGKIREVAWGVPPATKAERKLLVKIDWYILSFICLMYFSNYLDRANLSNAYVSGMKE
ALGMKGNDLNKVNTCFTVGYTIGMLPQNLLLQLVPARILFPLNTVTWGGLTMVTAAAKST
SHLCVIRFFQGIAESSTFVGAHYVMGSWYLEEELCKRAAIFSASAQIATLFSGILQARIY
KTMNGLHGLPGFRWLFIICGVITVPIGLYGYLFFPDTPSRNRSLVFSASERHLALSRLPP
RPETKLDRTVVRRVVGRWRWWLMSMIWIVGGELESIGSNALMAIWMKHQTSIGAHSWTVS
NFNYYPNGATAVSIVALLTTAVWTDYTKKRYQVNLVISAVMVVAAALILAQDQIGTGAVF
FAFYIAGISYAGQAFNFSWANDLTRDDEQERGIVLASMNMFSNAFNAWWSIVFFPADHAP
YWRRGMISLIVLAPIMVVLTLAARYLQLRDQRLALQKGGTVEGERRRQDGGNVMEDGRMR
TEERREAEGRVSSEVEEEKV