Protein Info for mRNA_4039 in Rhodosporidium toruloides IFO0880
Name: 12407
Annotation: K00825 AADAT, KAT2 kynurenine/2-aminoadipate aminotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to TDID_EMENI: Aminotransferase tdiD (tdiD) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
KEGG orthology group: K14265, tryptophan aminotransferase [EC: 2.6.1.27] (inferred from 42% identity to mgr:MGCH7_ch7g1107)MetaCyc: 43% identical to L-tryptophan:phenylpyruvate aminotransferase (Aspergillus nidulans)
Tryptophan--phenylpyruvate transaminase. [EC: 2.6.1.28]
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (16/18 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of L-phenylalanine biosynthesis (9/10 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-tryptophan degradation VIII (to tryptophol) (3/4 steps found)
- L-methionine degradation III (2/3 steps found)
- L-phenylalanine biosynthesis I (2/3 steps found)
- L-phenylalanine degradation II (anaerobic) (2/3 steps found)
- L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- L-tyrosine degradation I (3/5 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- superpathway of plastoquinol biosynthesis (1/5 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
- terrequinone A biosynthesis (1/7 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
- (S)-reticuline biosynthesis I (3/11 steps found)
- rosmarinic acid biosynthesis I (2/10 steps found)
- superpathway of rosmarinic acid biosynthesis (2/14 steps found)
- superpathway of chorismate metabolism (28/59 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.6.1.27 or 2.6.1.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (441 amino acids)
>mRNA_4039 K00825 AADAT, KAT2 kynurenine/2-aminoadipate aminotransferase (Rhodosporidium toruloides IFO0880) MTQQQSTVNWDEYISERGKMWEPSAIRGLFPLEKIPGMVSLLAGKPNAETFPFSAIKVDL KPIIPGDAVETLTIESDALSEGLQYGATAGLPSLNKWLENLQEVRHKRARDGSWGLSLGS GSQDLINKAFYSLVNEDDSILLETPVYSGTIGLLKRHKVNLMEVPVDTQGLDPEKLEDIL ANWKSKFPGKRFPKILYTIPTGSNPTGATAPLERRERVLALVRKYKLILLEDDAYHYLSF DPEHIVPSYFELEGRDGGEVGRVIRFDSFSKILSSGMRLGFVTGPKPILEIIDLHTANTN LQPSSTTQAMVLVLLNKWGLDGFLAHTRRVAAFYKDKRDMFEKVAHKYLDGLATWVTPEA GMFLFLDLHLTTDGTPGDSSELISATAVQKGVLAVPGVGFLPNGGRSSFVRVSFSLATEE DAELAFQRLRECILEARGEKA