Protein Info for mRNA_4091 in Rhodosporidium toruloides IFO0880

Name: 12459
Annotation: K03362 FBXW1_11, BTRC, beta-TRCP F-box and WD-40 domain protein 1/11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 856 PF00646: F-box" amino acids 242 to 284 (43 residues), 40.8 bits, see alignment 3.1e-14 PF12937: F-box-like" amino acids 243 to 286 (44 residues), 49.6 bits, see alignment 6e-17 PF00400: WD40" amino acids 561 to 593 (33 residues), 23.4 bits, see alignment (E = 1.7e-08) amino acids 598 to 633 (36 residues), 23.3 bits, see alignment (E = 1.8e-08) amino acids 649 to 681 (33 residues), 20.2 bits, see alignment (E = 1.7e-07) amino acids 686 to 721 (36 residues), 12.4 bits, see alignment (E = 5.2e-05) amino acids 725 to 763 (39 residues), 30.4 bits, see alignment (E = 1e-10) amino acids 767 to 805 (39 residues), 28.8 bits, see alignment (E = 3.3e-10)

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (856 amino acids)

>mRNA_4091 K03362 FBXW1_11, BTRC, beta-TRCP F-box and WD-40 domain protein 1/11 (Rhodosporidium toruloides IFO0880)
MTDHDPSRPSHPPHSSSLEDSITDSHTPMGTSAALEVPSRGRRGLSEYGAEAGEADADTM
EVDPHPLGSLSSSRTNPLTFLASSSPSRALSRMWDRFSPPSISSPFHLPHPHAFPPNFLA
RSAPPSSPDPTIPAETDLFAPQRQARPILEQHDSASQLSFSLRRGSEAGVGGRLPMSSVR
EEEAVPASRWRSASEGWESPFKLPTMPWKGKEKDNSPLESNILGYDDEACFVDGLEGKVD
FLASLPSEISLHILTHLDFRDVLSVSLVSRQWRILALDPLLWRDLFHQNPRWHIKPEAYR
AAAQAAQAAQAAAAAAKEAASASSNGSSTHQTSDRPVMPNLKRAASSFGRAGAKRLVTGA
DKVSHGGAVIGRKLSEIVGDFGGLSLVPGMASAPSSRGHSRAPSENGDVSMEPSQTRPPT
RPSPNRRPTGSTPLLSLSTAGPPSLSTLQTNAFASPPSATLSRNNSSSALSSLTSALPTT
MTTPRRNSAAPPPVAPNSPIPTSKPRLPSSPYSNTARPATAEFDELTDPAGAASLYLDWP
RLYRDRWLLERRWQRGKPSWSWFEGHTDSVYCIQFDERKIISGSRDQRIRIWDIASGTTI
HTLTGHEGSVLCLQYDSSILVTGSSDSRVIVWDLVGDEATGKGKYEQKMTLVGHAMGVLD
LCFDDKWIVSCSKDTTTRVWNRSTGELYRVLQGHRGPVNAVQLHGDHVLTASGDALMKLW
DLHTGQTIRTFSGHSRGLACVHWAPSGSHFVSSSNDKTIKLWNAETGECVRTFVGHTDLV
RGLAYDEKSKMIVSGGYDRSTRVWDAETGREIHKFKSHASLVFDVAFDASRIISSSHDKR
ILLMNFGVGLDVDKFA