Protein Info for mRNA_4100 in Rhodosporidium toruloides IFO0880

Name: 12468
Annotation: K01253 EPHX1 microsomal epoxide hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF06441: EHN" amino acids 11 to 124 (114 residues), 110.2 bits, see alignment E=6.9e-36 PF00561: Abhydrolase_1" amino acids 110 to 213 (104 residues), 58.2 bits, see alignment E=1.1e-19

Best Hits

Predicted SEED Role

"Epoxide hydrolase (EC 3.3.2.9)" (EC 3.3.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.9

Use Curated BLAST to search for 3.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>mRNA_4100 K01253 EPHX1 microsomal epoxide hydrolase (Rhodosporidium toruloides IFO0880)
MATHTFASPPTRFTVDIPQSELDELHSRLDKTRWPATEIVPEDGTDDPTAFGLGAGPTLP
LMKELAKGWREFDWKKAQDHLNTFEHYMVEIEDLSIHFLHHRSTRPNAVPLILCHGWPGH
FGEFLNVIPLLTEPSDPSAQAFHVVAPSMPGYAWSLPPPSSKWNMPDTARVFDKLMTGLG
YEKYMAQGGDWGSIAARCLGSLHKDHCKAVHLNFLPVFPPVPMWLINPHTLLAWAPRFLV
PEKQAARMKRGLAYLEKGLHWEAKLTLRRPQPRTPAYGLTDSPVGLLAWIGEKFEPTIQE
ASKQAQPTLTRDELYFTCSLYWFTRSIGTSFLPYSLNPHFTTFLTDSKYHLPNFALSLYP
GEIYCPAERDAKRTGNLKWIKDAPEGGHFAALEKPDVFVEHLREAFGVMWEK