Protein Info for mRNA_4143 in Rhodosporidium toruloides IFO0880

Name: 12511
Annotation: HMMPfam-Acetyltransferase (GNAT) family-PF00583,HMMPfam-Acetyltransferase (GNAT) domain-PF13444,ProSiteProfiles-Gcn5-related N-acetyltransferase (GNAT) domain profile.-PS51186,SUPERFAMILY--SSF55729

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF13444: Acetyltransf_5" amino acids 34 to 87 (54 residues), 29.9 bits, see alignment 1.9e-10 PF00583: Acetyltransf_1" amino acids 68 to 120 (53 residues), 23.6 bits, see alignment 1.3e-08 amino acids 227 to 327 (101 residues), 31.6 bits, see alignment E=4.5e-11 PF13673: Acetyltransf_10" amino acids 74 to 166 (93 residues), 37.5 bits, see alignment E=5.3e-13 amino acids 241 to 347 (107 residues), 42.6 bits, see alignment E=1.4e-14 PF13508: Acetyltransf_7" amino acids 242 to 328 (87 residues), 35.9 bits, see alignment E=2.2e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>mRNA_4143 HMMPfam-Acetyltransferase (GNAT) family-PF00583,HMMPfam-Acetyltransferase (GNAT) domain-PF13444,ProSiteProfiles-Gcn5-related N-acetyltransferase (GNAT) domain profile.-PS51186,SUPERFAMILY--SSF55729 (Rhodosporidium toruloides IFO0880)
MASTYNAPLIPSAAPAYSTVLCSTPEQMQRAMAIRHKVFCEEQGYDPAIEVDELDALCDH
LLLTKKNEDGTEEDVGTLRWYPPKGKVGRVAVHKQFRGTGAGSTLCLALEEHVRERRGKA
ADVTRGKETFDLIAHSQKIAEVFYHRLGWKTVGEDFLEEGQPHCKVVKTIQLNPEPAIAV
LNGSKPPTRSYAVRWCETQADIDRCIQIRIAVFVDEQGFSMEDELDEKDPVSDHFLMTTV
DAEGKEEDVGTIRWWPKPGLAAGKIGRVCVLPKYRGGGTGKLLMTSIEEHVRNRRGKAGE
ASKGKESVTAVVHSQMHAEGFYSKAGYVREGDKFMEDGAFHCKLVKEIQLVPETA