Protein Info for mRNA_4199 in Rhodosporidium toruloides IFO0880

Name: 12567
Annotation: KOG1303 Amino acid transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details amino acids 440 to 465 (26 residues), see Phobius details PF01490: Aa_trans" amino acids 68 to 467 (400 residues), 100.5 bits, see alignment E=4.6e-33

Best Hits

KEGG orthology group: None (inferred from 43% identity to scm:SCHCODRAFT_56175)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>mRNA_4199 KOG1303 Amino acid transporters (Rhodosporidium toruloides IFO0880)
MAAADLEKAPPSYDTTTPGDHHHPHTHNHASLAPARSRSLRHEKHDKVEVDEIIQSEQVS
IAGINERKLTWVQAAALLLTEYVVLAILAFPYSFQLLGYAGATITSVLIAASTWYTSLIL
WRFCMRHPEVRDIADAAQVVCGGRRIGWWLAFIGLALNNWCIMGLHTVAGATAIQTIRGG
KEVTLVWAIGLTLIMWFFSNLRDFSSMSKVGMLASSTMFVCVLIVLCGHGVQPHPTGWTP
GLVITHSVWAPKGTTFVQGMNALLNIVYTYIGHALIPSFVGDMERPQDFPKALAISMVAE
VLLFTVTGAVVYHYTGFELTTAPAYGSLIAKYGKVAAGFTLPTICIVGILYSLVTSRAIY
FQIFKEGSPHRSSHTLIGWLSWIGIVFGGWVISFIIGEAVPFFSDLLSLISSLFDSWFGY
ILWAIAYFQMTKGRRTAGAIATAETVLNVLILITGFFFFTAGTYASVQSIIDSYNKGAVK
TPFTRANTGFVLDTF