Protein Info for mRNA_4279 in Rhodosporidium toruloides IFO0880

Name: 12647
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 75 to 97 (23 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 141 to 170 (30 residues), see Phobius details amino acids 173 to 186 (14 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 293 to 320 (28 residues), see Phobius details amino acids 339 to 362 (24 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details amino acids 440 to 464 (25 residues), see Phobius details amino acids 476 to 499 (24 residues), see Phobius details PF00083: Sugar_tr" amino acids 78 to 247 (170 residues), 33.3 bits, see alignment E=2.6e-12 PF07690: MFS_1" amino acids 79 to 462 (384 residues), 135.1 bits, see alignment E=2.9e-43

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>mRNA_4279 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MTTAQRNDDVSSTILADAPAPDRANTTDDLEAAKGADAVRDVEVKEEGARDVPAEWLESP
EHPWNWPLSTKWTNTTVIAVTGFLSTLDSSIFVPAMPILEDRYHSSREVITLTTSLYVAG
LGCGPFVMAPIAELYGRQRAYSISMIGFTLMNLVCCFVDSLPGLIVLRFLSGFFGSSGPG
LGVATISDLFRPQERGRPIAIYAIGPMLGPVLGSILGNWLVLLDFRWPFRLMTILIGLNT
LAVLFLMRETYAPVLERAYLARRNGRGKADKPSRSLAKAVVVRTFSRPPRMLFNPVCALF
ATYYAYTYGIIYVFIVSLPLLFAKHDPPTGIFTYGWPTGTAGLCYIGLGIGFVSSAATAA
LFQDRIYQYLSRKYKNQGVPEYRLVITQIGMIIFPIGLFIFGWTAQAQTHWMGPMIGSII
FSYGLMLTFNSIQNFIVDAFVPYSAAAMAAATLLRSSTGAILPIFSPQLFINLNYGLGAT
LLACVSLPAVPAPLILFMMGEKLRDRWRFKA