Protein Info for mRNA_4281 in Rhodosporidium toruloides IFO0880

Name: 12649
Annotation: K11778 DHDDS, RER2, SRT1 ditrans,polycis-polyprenyl diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 45 to 269 (225 residues), 224.8 bits, see alignment E=4.8e-71 PF01255: Prenyltransf" amino acids 51 to 270 (220 residues), 238.8 bits, see alignment E=2.8e-75

Best Hits

Swiss-Prot: 46% identical to YE54_SCHPO: Dehydrodolichyl diphosphate synthase complex subunit SPAC4D7.04c (SPAC4D7.04c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K11778, ditrans,polycis-polyprenyl diphosphate synthase [EC: 2.5.1.87] (inferred from 52% identity to cci:CC1G_08115)

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31 or 2.5.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>mRNA_4281 K11778 DHDDS, RER2, SRT1 ditrans,polycis-polyprenyl diphosphate synthase (Rhodosporidium toruloides IFO0880)
MKAPTDPAASDVHLPFSSFLTWIPQSVHPFLRSLLIASLRLGPRPQHVAFIMDGNRRSAR
ERKLPVRVGHEEGFEALKRVLSFLLKLEIPHVTVYAFSIENFNRDPMEVEALMDMARKRL
VEICQHGALLDQHGIQIRVLGRRDLLPPDVQESCAEAEALTAGNTKGILNLCCPYGSQEE
IATAIKRTVESCHEGKLSPSNITEEHIAANLYTAASPPLDILIRTSGVSRLSDFLLWQSN
ESTILHFITPNWPDIGVADILPPLLSYQAEVWVGQVSDTLESWRRWSVGERTSRRVKAE