Protein Info for mRNA_4347 in Rhodosporidium toruloides IFO0880

Name: 12715
Annotation: K03386 PRDX2_4, ahpC peroxiredoxin (alkyl hydroperoxide reductase subunit C)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00578: AhpC-TSA" amino acids 5 to 138 (134 residues), 128.4 bits, see alignment E=2.3e-41 PF08534: Redoxin" amino acids 6 to 147 (142 residues), 50.9 bits, see alignment E=2.2e-17 PF10417: 1-cysPrx_C" amino acids 159 to 195 (37 residues), 44.8 bits, see alignment 1.3e-15

Best Hits

Swiss-Prot: 68% identical to PRDX2_BOVIN: Peroxiredoxin-2 (PRDX2) from Bos taurus

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 67% identity to mpr:MPER_10926)

MetaCyc: 62% identical to peroxiredoxin-1 (Homo sapiens)
1.11.1.15-RXN [EC: 1.11.1.24]; 1.11.1.24 [EC: 1.11.1.24]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>mRNA_4347 K03386 PRDX2_4, ahpC peroxiredoxin (alkyl hydroperoxide reductase subunit C) (Rhodosporidium toruloides IFO0880)
MVARVQQPAPAFEATAVVDGFFETVKLEQYKGKWVVLFFYPLDFTFVCPTEILAFNQRLS
DFSALNTEVLAVSTDSEYSHLAWANTNRNEGGLGPDLKLKLVADKSMKISRDYGVLLEDA
GVALRGLFLIDPKGTLRQITINDLPVGRSVDETLRLIKAFQFTDEHGEVCPANWDPESKS
ATIKPDPKASKEYFSAQNSTPTNGENGREKPVTGVSPDAKRRKVE