Protein Info for mRNA_4349 in Rhodosporidium toruloides IFO0880

Name: 12717
Annotation: K02873 RP-L13e, RPL13 large subunit ribosomal protein L13e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF01294: Ribosomal_L13e" amino acids 8 to 187 (180 residues), 254.3 bits, see alignment E=3.3e-80

Best Hits

Swiss-Prot: 56% identical to RL13_SCHPO: 60S ribosomal protein L13 (rpl13) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02873, large subunit ribosomal protein L13e (inferred from 66% identity to scm:SCHCODRAFT_72959)

Predicted SEED Role

"LSU ribosomal protein L13e" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>mRNA_4349 K02873 RP-L13e, RPL13 large subunit ribosomal protein L13e (Rhodosporidium toruloides IFO0880)
MGFRHNNVLHRNHFRKDWQSRVKTWFDQPGKKHSRRVARQEKAAKAGLRPTELLRPAVRP
PTIRYNRKLRAGRGFTKAELKGAGIRAKEALSIGIPVDHRRRNRSEEGLKLNVERLEAYK
ARLVVFPKKAGKVKKGDTEGADKSTPAVKSAQAAFPIPAGMTAEQPRSITSEEKEFNAYA
ALRKARSDARLVGVRAERERKKREEEEAKRK