Protein Info for mRNA_4375 in Rhodosporidium toruloides IFO0880

Name: 12743
Annotation: K14209 SLC36A, PAT solute carrier family 36 (proton-coupled amino acid transporter)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 815 transmembrane" amino acids 417 to 436 (20 residues), see Phobius details amino acids 442 to 464 (23 residues), see Phobius details amino acids 485 to 509 (25 residues), see Phobius details amino acids 526 to 545 (20 residues), see Phobius details amino acids 553 to 572 (20 residues), see Phobius details amino acids 594 to 614 (21 residues), see Phobius details amino acids 626 to 650 (25 residues), see Phobius details amino acids 674 to 695 (22 residues), see Phobius details amino acids 716 to 734 (19 residues), see Phobius details amino acids 740 to 762 (23 residues), see Phobius details amino acids 774 to 797 (24 residues), see Phobius details PF01490: Aa_trans" amino acids 412 to 794 (383 residues), 280 bits, see alignment E=1.4e-87

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (815 amino acids)

>mRNA_4375 K14209 SLC36A, PAT solute carrier family 36 (proton-coupled amino acid transporter) (Rhodosporidium toruloides IFO0880)
MALPRPTSPLNDGHTLVQSGISLAVPQIPPHNAPSSSTPPAAGSPLAGSPRRSPSPLLAV
ASSALQQTRTDSPLPPNAVQPAAPSPVPLTEAQKAEVIRRHLLTAEEQQRLAADQALTSS
SPRSSSAFPQPTAEDDSEFPTPYHLQGGDVVAGVYKWAQQAVEEAGGSASGGGGSSGATP
VPGLGVGKAPSVRRSRSMASIVEGVASRRTSLAVGAGGGDAGRAAARAGIGADEVLASDV
EDEGGLLSTAEMLQPGGFRRDFVFRKMAAQDQQPTSSPSASAYASAAIGANPSSTSLASL
GSQGANGNASGISLGAASPSPATRARPTRSFIDFLSLYGHFGGEDLEEIEEEEEEEEEDE
EAALESAVGQRGLAPRGPHERTPLIRARSSMRGDSRKRVGAATGDAEKVGDATVTQAVLM
LLKSFVGTGVLFLGKAFFNGGILFSTITLCFVAMISLYSFLLLVQTRQAVPGSFGDIGGA
LYGRWMRWAILFAIVLSQIGFVAAYTIFVAQNLQAFFLAVSNCKTYISTPLLILAQLVVF
LPLAMIRNIQKLSSTALVADAFILFGLVYIFSNEAKVLAQHGIADVKLFNPRDFPLLIGT
AVFAFEGIGLVLPVRESMRDPSRFPAVLSGVMVGTMVLFASGGVLAYLAYGSQIQTVVFV
NLPSDDKFVQTSQFLYSLAILLSTPLQLFPAVRIMENGLFPQRSGKRSLKVKWEKNGFRA
AVVVGCAGISWAGASDLDKFVSLIGSLACVPLGFIFPALLHFKACARTRSQKAADLALLV
FGVVAAVFSTSQTINLLLKAGESGPPTMGRCPPRA