Protein Info for mRNA_4424 in Rhodosporidium toruloides IFO0880

Name: 12792
Annotation: KOG3860 Acyltransferase required for palmitoylation of Hedgehog (Hh) family of secreted signaling proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 transmembrane" amino acids 60 to 78 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 338 to 351 (14 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 459 to 478 (20 residues), see Phobius details amino acids 524 to 549 (26 residues), see Phobius details amino acids 556 to 573 (18 residues), see Phobius details amino acids 592 to 613 (22 residues), see Phobius details amino acids 630 to 650 (21 residues), see Phobius details PF03062: MBOAT" amino acids 325 to 611 (287 residues), 146.5 bits, see alignment E=6.7e-47

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (665 amino acids)

>mRNA_4424 KOG3860 Acyltransferase required for palmitoylation of Hedgehog (Hh) family of secreted signaling proteins (Rhodosporidium toruloides IFO0880)
MGAQLHPRLPSPIPQQPLRNRTPGKQRWSITDLTVHTPSTASPAYNAQQGSQPRWRTKEF
YAYYLVFALVVPQMWRIGCKATRATSEGYWKYAGRLRNGWLFGWKVDVTDAQYYLFRSKL
PLLVALMLFHLSLSHAFRFLSRRLSPSHNPSSPHFDAKRARDARAAFSAFFSVALLAVLH
GSSLPKLLIILGVNYRIAMLGAPSSSSNDRKRWRREWTPYATWAFNVTILFANEICSGYK
WGSLNSALSWLDDYGGLLPRWHISYNISMLRLVSFNMEYYWAWSSKIAENEGEIGVGLPE
PPTSPRVKAAQQFQSTPRTSSSTIAPDPSPPASNYSFIHFIAYVLYPPLYLAGPIMTYPS
FLAQLAPTAQPASTSNGGASTPVMELATDPLLLSASSASLNRLSTPPAPSETSPRALLSY
TIRFLSCLLTMELLLHSMYVVALKDSGKGWWNGMTPAEVSMVGFWNLIVVWLKLLLPWRL
FRLWALLDGIVPPENMVRCMANNYSTLGFWRSWHRSYNMWVVRYLYIPLGGSARPFLATL
GVFTFVALWHDLRLRLLIWGWGVTLFVVPEMIARKAVPYSKYGSKPWYRHLAAVGGVANV
LLMMTANLVGFVVGVDGARELWKVMLGGWAGRLFLLFASACLFVAVQIMFEYREEERRRG
ISRKC