Protein Info for mRNA_4482 in Rhodosporidium toruloides IFO0880

Name: 12850
Annotation: K03144 TFIIH4, GTF2H4, TFB2 transcription initiation factor TFIIH subunit 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 TIGR00625: transcription factor Tfb2" amino acids 25 to 480 (456 residues), 502.2 bits, see alignment E=7.4e-155 PF03849: Tfb2" amino acids 26 to 391 (366 residues), 417.1 bits, see alignment E=5.7e-129 PF18307: Tfb2_C" amino acids 410 to 477 (68 residues), 89.7 bits, see alignment E=1.3e-29

Best Hits

Predicted SEED Role

"Transcription initiation factor IIH p52 subunit" in subsystem RNA polymerase II initiation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>mRNA_4482 K03144 TFIIH4, GTF2H4, TFB2 transcription initiation factor TFIIH subunit 4 (Rhodosporidium toruloides IFO0880)
MAYDLLDKAAGSTPGELDASHLYGLLDRLSAAMFTRLYASPASCLSIFRLLPVTSRHIVL
NMLWYEEVVRVRDVALWVRERKSEGGDKGERRHLSSSLSALARLHIITPRSSRPSDTSKD
ETELEMNPGFRDSFRMALTGGGKQGSFGAPAAEQDEEVTVQFLDDHAEVQWETIQHFMVG
SDAGAKKPGEKVLSLLERSGLMYSPTRSLRNMRITSKGFQFLLEDVNTQLWDLLLVYLEG
SQDLVETIGFLFMLGSLELGRAYMTDNLSQIQHGVLRDLADYGLVYLPERNAPIFYPTRL
ATTLTSSAPPLVSSRHSNEEKGFIVLETNYKLYAYTSNPLQIAVLGLFAHLKTRFANFVT
GHITRESIRRGLANGITANQIISYLASRAHPQMRAQAGSDDKLLPITVVDQIRLWEHERR
RIQTTEGYLYDEFSSTHDYELVVNYAREIGSVLLELPKARKVFVTADGHQQVREFIKRRM
AAAQAEAQAMEGQEPA