Protein Info for mRNA_4534 in Rhodosporidium toruloides IFO0880

Name: 12902
Annotation: K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 442 to 465 (24 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details TIGR00800: NCS1 nucleoside transporter family" amino acids 26 to 468 (443 residues), 430.2 bits, see alignment E=4.4e-133 PF02133: Transp_cyt_pur" amino acids 31 to 484 (454 residues), 435.4 bits, see alignment E=1.2e-134

Best Hits

Swiss-Prot: 50% identical to YEME_SCHPO: Uncharacterized permease C29B12.14c (SPAC29B12.14c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 58% identity to scm:SCHCODRAFT_60986)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>mRNA_4534 K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family (Rhodosporidium toruloides IFO0880)
MSLFRRLISSTELRQPDGRSASFLVNRDLLPVPPEERQWTAINYWAFWCADSVNLSTFMI
ASSGISLGLSWWQCWLAVWVGYGIAAVFLVLNAYAGAVLHIIFPAYIRASFGVLGGLWPA
LNRAFMACVWYGVQSWIGGTCVYTFLLAIFPSLARLPNGIPSSGTDTAHFLCFFLFSLVS
IVPIYFPMHKIRHLFTLKAIVSPIAAIALFAICIHKAHGGGSLLKQPASITGSTLGWAFV
AQVMSNLSNMATLVTNSVDFASRASKPSDVVVPQLIAMPFCFALTSLFGIFIGSSSQVIF
GEFVWSPLDVMTKFLTVEGGASHGMRAGVAFISLGFIVAQLGTNIAANALSAGCDLTSIF
PRFINIRRGGYIAALVGFVMCPWNLLSSSTNFSTYLSAYSVFLSSIVGVMIAHYYLVARR
RVKVADLYSLERESIYRYMYGFNLRAFAAYIAGILINVVGFAGAIGRTVPYAAQRIYDLS
FLCGFSVSAVVYTLLCYFFPVPVPTDAEMLEQPAALEGRVESRKDGEASVYEEEKKEVEG
TASVELV