Protein Info for mRNA_4541 in Rhodosporidium toruloides IFO0880

Name: 12909
Annotation: K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 365 to 390 (26 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 448 to 469 (22 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 3 to 442 (440 residues), 286.3 bits, see alignment E=2e-89

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>mRNA_4541 K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family (Rhodosporidium toruloides IFO0880)
MEPVPPEHRTWGSGTFAAYWFSDLINAGSWSQISSFVSLGLTWWQGLLATFTGGVLLCIV
IVANGIVGSRLHVPFAISSRASFGYYLSRFVICSRMVIAMFWLSVNTWQGGRSIKICLTA
IWPSFAHFKNRIPASSGFTSADMLCFFLFWLIQFPFCLVHPRKLRPVFLAKAIFLPIVAV
AMMGWTIHEAGDHASEVLKAKPTLHGLEGWYAFMTAVTACMGTWSTMACNISDFSRYTRK
ETAAWTQMLFVPALWTVCALFGSIAANMTTVIPRYQGVATFQPFDIIENGGWLESHGGRA
AAFFCSLAWGVGNMTTNITANSISAANDMASLFPKWISIFRGQLIAIVIGVYAFAPWKVL
ASAGAFISFMGAYSIVLAPIAAILCADFFLVKRGKYNVPELYNFGEGIYRYTYGFNLCAL
GALLISIPPNLPGMINALNSKVDIGNAKYIYCMADIFGIVVAAGSHTLLSKLFPDHKTLI
AEAVLVDDVLDGRVPGYEHLARRSATASLTPSSEKLEPEAGIHPAEV