Protein Info for mRNA_4581 in Rhodosporidium toruloides IFO0880

Name: 12949
Annotation: K17964 LRPPRC leucine-rich PPR motif-containing protein, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 954 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13812: PPR_3" amino acids 635 to 691 (57 residues), 24.1 bits, see alignment 7.6e-09 amino acids 707 to 764 (58 residues), 41.6 bits, see alignment 2.7e-14 PF13041: PPR_2" amino acids 649 to 691 (43 residues), 38.6 bits, see alignment (E = 2.6e-13) PF01535: PPR" amino acids 650 to 680 (31 residues), 23.8 bits, see alignment (E = 9.3e-09) amino acids 903 to 932 (30 residues), 22.4 bits, see alignment (E = 2.6e-08) TIGR00756: pentatricopeptide repeat domain" amino acids 650 to 683 (34 residues), 26.9 bits, see alignment (E = 1.8e-10) amino acids 903 to 933 (31 residues), 25.8 bits, see alignment (E = 3.8e-10)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (954 amino acids)

>mRNA_4581 K17964 LRPPRC leucine-rich PPR motif-containing protein, mitochondrial (Rhodosporidium toruloides IFO0880)
MPSPRLVSSSRALLSTAAAQQGLLDVFAPAAFASLSLHPRAYSQASSRPPPRSSAPPSNH
PSRSQDHPPQRRDSSPSRRNGPRPPQSRSRQPAPKKEQSLTERLRMARQDSSTTPSPSTS
NAPNPADLLSEIRAAAPSGPAASASPNDDLSTLSPVQVQNQAVLNLVNAVSTRLRNYDVM
FVKGWKPLREAGQIGRMKESDVAEILWAALAKIRETGPAGEGTHWHWKEVRELALWVAGG
SERTLVTDWAWQNIYLGYEGCERVIDLWEAICRGEAAALRRAPNGPNHAFKPAMQALRED
GAPEQIRLPAGLFNVSCVAHALLRARLDPSERPSFASMIPKFVSPHLRGMKALTPEFGMD
HRLRILRTCAVYKADRSNAVVPSGIVTPSVVDTAIIPFLRQVGLARDWYAKNDPPGARVV
KEIQALLRAGSQKQAWKLWNLVQEALASPDLAWLGTDEWLDSSRSKIFVTDEDGNLINAA
QPDQGNLPPDEMDTKETSAEAESEEDVLDEDAALAGETVSLAAPVEPAQLHQRHIGGILV
GFVKAKLMDHANTIWGWLAERGLSPGVACWTGLLNGYVAGGALASVEAVFRDMQRTPGLE
PDYYSWMARSKAHFAAKDPEAAMRCAREMMRDKHVLDDLQRSGLKTFPVVTWDSLIDGLL
SCGRRLEADALFDEMQKSGLEPSMRTFNTFLAYSTRGKRPDLATMIRLLQQIAERGLEPD
VYTFTMVLHALLAVGQKDATTRTIEMMQAAGIKPTRATYGAVIHNLSSSGEPEKLSAALQ
LLDEMESKKMDTNEIIYTSLIQNFLRAIGTSGSGHTTSEGRHPYADAAMMLKKRMEARGK
HLNRIGYNALIAAGFSLQSEWGTNLAMRMFAELKRRPNTLHSSLTASQRKESGNTDRMLV
NGTYYVMLDGLVRNGDYSTARNILHEMERSGFEVRSKPLQRLVRQVQSGFLMND