Protein Info for mRNA_4598 in Rhodosporidium toruloides IFO0880

Name: 12966
Annotation: K00418 QCR8, UQCRQ ubiquinol-cytochrome c reductase subunit 8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 transmembrane" amino acids 64 to 82 (19 residues), see Phobius details PF02939: UcrQ" amino acids 20 to 95 (76 residues), 102.9 bits, see alignment E=3.5e-34

Best Hits

Swiss-Prot: 46% identical to QCR8_SCHPO: Cytochrome b-c1 complex subunit 8 (qcr8) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00418, ubiquinol-cytochrome c reductase subunit 8 [EC: 1.10.2.2] (inferred from 46% identity to spo:SPAC1782.07)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>mRNA_4598 K00418 QCR8, UQCRQ ubiquinol-cytochrome c reductase subunit 8 (Rhodosporidium toruloides IFO0880)
MRASSAVHSGMPTGNKYMGWWGDMGGPTQKGISQYVVSPFRQAPMRGAFSHYLHNGVRRL
GQQAVYFVVPFAAAYGILQWAIKDNHLRNSKHGQAQGLFP