Protein Info for mRNA_4606 in Rhodosporidium toruloides IFO0880

Name: 12974
Annotation: HMMPfam-Zinc-binding dehydrogenase-PF00107,HMMPfam-Alcohol dehydrogenase GroES-like domain-PF08240,ProSitePatterns-Zinc-containing alcohol dehydrogenases signature.-PS00059,SUPERFAMILY--SSF50129,SUPERFAMILY--SSF51735

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF08240: ADH_N" amino acids 12 to 89 (78 residues), 61 bits, see alignment E=9.6e-21 PF00107: ADH_zinc_N" amino acids 131 to 264 (134 residues), 61.7 bits, see alignment E=7.6e-21

Best Hits

KEGG orthology group: None (inferred from 61% identity to ang:ANI_1_234144)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>mRNA_4606 HMMPfam-Zinc-binding dehydrogenase-PF00107,HMMPfam-Alcohol dehydrogenase GroES-like domain-PF08240,ProSitePatterns-Zinc-containing alcohol dehydrogenases signature.-PS00059,SUPERFAMILY--SSF50129,SUPERFAMILY--SSF51735 (Rhodosporidium toruloides IFO0880)
HGRIGDSMVVRETCGAGHESAGEVYEVGPGVEGLKKGDRVALEAGLPCGECEFCRIGRYN
ACPDVVFFSTPPYHGMLTRFHAHPASWVHRLTDSISYEEGALLEPLVVALAGIERAGLRL
GDPLLICGAGPIGLISLLAARAAGATPIVITDIAQSRLDVAKQLVPGVKTVLVERGVEPK
DVAAKIKKEAGLPLGLSVALECSGVESSVQTAVYASKFGGTVFVIGAGKDFQSLPFMHMS
VNEIDLKFQYRYANQYPKAIRLVEAGLINLKPLVTHRFTLETAIEAFETAVDVTRGATKM
QIHDEAL