Protein Info for mRNA_4620 in Rhodosporidium toruloides IFO0880

Name: 12988
Annotation: K05293 PIGU phosphatidylinositol glycan, class U

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 84 to 103 (20 residues), see Phobius details amino acids 150 to 175 (26 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 302 to 318 (17 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details PF06728: PIG-U" amino acids 10 to 339 (330 residues), 279.3 bits, see alignment E=5.6e-87 PF05007: Mannosyl_trans" amino acids 164 to 307 (144 residues), 24.8 bits, see alignment E=2e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>mRNA_4620 K05293 PIGU phosphatidylinositol glycan, class U (Rhodosporidium toruloides IFO0880)
MAAAAATGALGALLRLTLALDPSIPAKLAQRSEVATPLSSWTRLREGHFLLTRGANPYAA
GSFHGPPLLLALAGPLTGETSAARWASLAAWIAADLGTAWALARVAERRQRGALSAVEGE
TRWSGTRVAAIYLFHPFSIATTLARCSTTFANLFLALAIEAAVSGSAIQTAFFLSLATHL
SLYPVLLLPPLLLLVARHSVDSSAKTDRRVLARTALTGVAAFLLHQAVLISASRWWTGGW
EFLSSAYGVILTIPGLTPNIGLAWYFFIEMFDHFRSFFLVIFALHPLVYVAPLSIAYRRD
PLFAVVVLIGTIALLKSYPSFGDWGFWHALLGCYSELLPCGSLYLSPSGLD