Protein Info for mRNA_4628 in Rhodosporidium toruloides IFO0880

Name: 12996
Annotation: KOG0253 Synaptic vesicle transporter SV2 (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 61 to 86 (26 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 134 to 165 (32 residues), see Phobius details amino acids 188 to 212 (25 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 422 to 445 (24 residues), see Phobius details amino acids 465 to 483 (19 residues), see Phobius details amino acids 492 to 510 (19 residues), see Phobius details amino acids 516 to 537 (22 residues), see Phobius details amino acids 550 to 573 (24 residues), see Phobius details amino acids 579 to 599 (21 residues), see Phobius details PF07690: MFS_1" amino acids 79 to 447 (369 residues), 51.6 bits, see alignment E=1.1e-17 amino acids 428 to 605 (178 residues), 41.2 bits, see alignment E=1.6e-14 PF00083: Sugar_tr" amino acids 98 to 290 (193 residues), 44 bits, see alignment E=2.3e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>mRNA_4628 KOG0253 Synaptic vesicle transporter SV2 (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MSTDEVEERSRGSFERDDEDDSGLSEDGSTNGRSGHPNQAEGSLTPLDATLEEIGMGRYQ
YSLLVLCGLGWMADNATLQLIAVILPRVQEHWQVGDRWIGLLSTSLFAGMMASSVGAWGW
GSYSDAKGRVPAFNLTLCVTAVFSMAAAFAPSFGMLCLALFLLGTGVGGSMPTDGTLFLE
NVPRSSHYLLTALSVFFSLGAIITSVLGLAILPRYSCPPVPPGGESTCDVKKDNNGWRIM
LFALGVMTMVMFLCRVLFFRLHESAKYLVAAERPSAAVFALQRISRINGQEANWDLQDVV
DDEVSALANDTDGSDGKRSPPSYAATGETTPESRPKSASPSLLPTSPRARNSDGDLDEEA
ADLSTFSLPSSVFSSTPATPRLRKDRPAWIDRLPVSWRSGADEYLARLDELLEPKWKRTT
TLIWVIWTLASAGYTIFNVFLPKFLESKLSDGGQPSSQEATLRDYVLYTVSGLPGSLLGA
YLVETSLGRAKTLAFSTLLTSAGTFVFVFVSSQFGVIASSMAVSLAATLMYAVIYSITPE
IFPTSLRGTACGIASALSRLAGIVAPLLTGALLSLSSTALPLLLSAVCFFTTAACAWGLR
SVEERMRRKRGGGGAPALAH