Protein Info for mRNA_4634 in Rhodosporidium toruloides IFO0880

Name: 13002
Annotation: K00873 PK, pyk pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01064: pyruvate kinase
  • amino acids 33 to 516 (484 residues), 617.3 bits, E=8e-190
• PF00224: PK
  • amino acids 33 to 374 (342 residues), 549.8 bits, E=2.2e-169
• PF02887: PK_C
  • amino acids 393 to 514 (122 residues), 128 bits, E=2.2e-41

Best Hits

Swiss-Prot: 69% identical to KPYK_AGABI: Pyruvate kinase (pkiA) from Agaricus bisporus

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 69% identity to scm:SCHCODRAFT_73013)

MetaCyc: 55% identical to pyruvate kinase (Mytilus edulis)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• Bifidobacterium shunt (14/15 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis I (from glucose 6-phosphate) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• mixed acid fermentation (9/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (529 amino acids)

>mRNA_4634 K00873 PK, pyk pyruvate kinase (Rhodosporidium toruloides IFO0880)
MLPYDQITTQLEWLQNLSIPPVAPEGLQHKSLRKTSIIATIGPKTNSPEMIHKLRMAGVN
VVRMNFSHGSYEYHQSVIDNTRKAVTMGEGRPVAIALDTKGPEIRTGNMLNDADIKINAG
HRMKFSTNPDYADKCDDKVMFIDYKNITKVLEPGKPIFVDDGILSFNVISIGSDEVDVEA
VNNGTLSSRKGVNLPGTEVDLPALSQKDKDDLHFGVKNGVDMIFASFIRRGQDVKDIRAH
LGEAGKNIKIIVKIENLQGVANFDEILRETDGVMVARGDLGIEIPASQVFMAQKMMIAKC
NLAGKPVICATQMLESMTYNPRPTRAEVSDVANAVLDGADCVMLSGETAKGSYPIQAVEM
MAETCLLAESAISYPALFNELRAMTPRPTRTAETVAMAAVAAALEQKAGAILVMSTSGNT
ARLVSKYKPPCPIITVTRNEQTSRQIHLHRGVYPMHYPHEKPSSDEGWQVDIDNRIRSGL
SRALELGIVRKRDTVVAIQGWRSGLGSTNTMRILSVPEDDSHFELRPVE