Protein Info for mRNA_4654 in Rhodosporidium toruloides IFO0880

Name: 13022
Annotation: KOG4253 Tryptophan-rich basic nuclear protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details PF04420: CHD5" amino acids 7 to 157 (151 residues), 166.9 bits, see alignment E=1.7e-53

Best Hits

Swiss-Prot: 40% identical to GET1_CRYNJ: Protein GET1 (GET1) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: None (inferred from 40% identity to cnb:CNBG3700)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>mRNA_4654 KOG4253 Tryptophan-rich basic nuclear protein (Rhodosporidium toruloides IFO0880)
MELIAWLLLTTFVVELLGWVGTDTLAGYIYAPFAPAAKQQRAQKAEILKLRAELAATSSQ
DEFSKWARIRRKLDKAVQDLESSNADSSAHRQQFNKTFKSALWVLTTVLPFIVSSYHRRT
PVFWLPKNWFGPLGWWLSFPSASAGAVAVSIWTMACRRTFTSTKSAIFAFVPSPAERTAQ
QFAKEQEKVKVGVTASGAEEKVHEKKEL