Protein Info for mRNA_4655 in Rhodosporidium toruloides IFO0880

Name: 13023
Annotation: K03124 TFIIB, GTF2B, SUA7, tfb transcription initiation factor TFIIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF08271: TF_Zn_Ribbon" amino acids 31 to 73 (43 residues), 48.1 bits, see alignment 6.4e-17 PF00382: TFIIB" amino acids 141 to 211 (71 residues), 75.2 bits, see alignment E=3.3e-25 amino acids 239 to 309 (71 residues), 33.8 bits, see alignment E=2.9e-12

Best Hits

Swiss-Prot: 37% identical to TF2B_KLULA: Transcription initiation factor IIB (SUA7) from Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

KEGG orthology group: K03124, transcription initiation factor TFIIB (inferred from 39% identity to ago:AGOS_ADR007C)

Predicted SEED Role

"Transcription initiation factor IIB" in subsystem RNA polymerase II initiation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>mRNA_4655 K03124 TFIIB, GTF2B, SUA7, tfb transcription initiation factor TFIIB (Rhodosporidium toruloides IFO0880)
MSLAQAFALKVDPSAPTKAEEFRQDLNVRLTCPDCGDAGQVIEEFSSGDLVCGNCGLVLG
DKVVDTRSEWRTFADSDGDDPSRVGGPADPLLDSTDQLSTVISFKDNNTGVARALQMAAS
RVAKDAQGGSGRDLQGAFREIATMCEAISLPKAIIDTSKMLFKRVDEEKALRGKSEAAII
AACIFIACRQGRVPRTFKEIVALTNVSKKEIAGAFKQIDKLFDTSSPHGASSTDLDSLIS
RICNHLALPVPLQRACSLCGQKTVDDGVLAGRNPITIASSCILFVSTLWGRRVDPKEIAK
VGGVQDSTIRTGYRLLLTVKERLVDSRWFDASRPADQRADWANITGRSSSSAAASAVGED
DDYA