Protein Info for mRNA_4673 in Rhodosporidium toruloides IFO0880

Name: 13041
Annotation: K01069 E3.1.2.6, gloB hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 3 to 251 (249 residues), 228.4 bits, see alignment E=4.5e-72 PF00753: Lactamase_B" amino acids 21 to 173 (153 residues), 36.5 bits, see alignment E=5.5e-13 PF16123: HAGH_C" amino acids 174 to 251 (78 residues), 80.4 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 52% identical to GLO21_SCHPO: Probable hydroxyacylglutathione hydrolase C824.07 (SPAC824.07) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 51% identity to cnb:CNBD3830)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>mRNA_4673 K01069 E3.1.2.6, gloB hydroxyacylglutathione hydrolase (Rhodosporidium toruloides IFO0880)
MRVIPVPCRSDNYEYLIIDEKTKTTAVVDPFDPPKLQAAAEKEGVQLGQFLLTTHGHHDH
AGGNEKTTQLYPNIKVYAGGENVSAVTEVLKDGDKFKIGELDVKAVYTPCHTRDHICYYI
EDKAKNERAVFTGDTLFISGCGRFFEGEPQEMHVALNEKLASLPDDTKVYCGHEYTTSNV
AFSKKVDPENPAILELEQFCKDNNVTTGKSTIGDEKEWNVFMRTSSPAVQKATNTTDPIK
AMGVLREMKNKG