Protein Info for mRNA_4732 in Rhodosporidium toruloides IFO0880

Name: 13100
Annotation: HMMPfam-Major intrinsic protein-PF00230,PRINTS-Major intrinsic protein family signature-PR00783,SUPERFAMILY--SSF81338

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 52 to 79 (28 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 115 to 118 (4 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details PF00230: MIP" amino acids 50 to 267 (218 residues), 103.5 bits, see alignment E=7.6e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>mRNA_4732 HMMPfam-Major intrinsic protein-PF00230,PRINTS-Major intrinsic protein family signature-PR00783,SUPERFAMILY--SSF81338 (Rhodosporidium toruloides IFO0880)
MQAQRGHLDRENGDLEVGVADLLQQRPDAHHSAPLPQPPAWLVNWERKRPALLVECLAEA
IGVFMYVFPGLGASAAFLVTTVAKEAGFGQLLNIGIAYALGIVFAIVVAAPTSGGHLSPS
FTLAFVVFKGFPIRKAPFYMLSQILGGFAAALAVYGIYKQQLDAVSAGFVKLGIAPEIFS
PSGPAGVLALFPQPTQALKWVFMNEFFANMFLAILVFSVLDLCNFFVSIPVAPFVIGLGY
LCIILAFAVNSVALNAARDVGGRFACGVIYGSKCFTANSGYTALAALTTFPATLVGALIH
TLFLSDTARMIVNAPPAMAEQVSLYNESRGFPSVGRSITRESVYRDQNGMPLKA