Protein Info for mRNA_4745 in Rhodosporidium toruloides IFO0880

Name: 13113
Annotation: K17086 TM9SF2_4 transmembrane 9 superfamily member 2/4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 271 to 293 (23 residues), see Phobius details amino acids 343 to 370 (28 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details amino acids 414 to 437 (24 residues), see Phobius details amino acids 448 to 472 (25 residues), see Phobius details amino acids 496 to 519 (24 residues), see Phobius details amino acids 532 to 560 (29 residues), see Phobius details amino acids 572 to 591 (20 residues), see Phobius details amino acids 603 to 632 (30 residues), see Phobius details PF02990: EMP70" amino acids 56 to 599 (544 residues), 608.3 bits, see alignment E=6.4e-187

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>mRNA_4745 K17086 TM9SF2_4 transmembrane 9 superfamily member 2/4 (Rhodosporidium toruloides IFO0880)
MLRLLALSVLAVPLARAFYLPGAAPNAFVDDELVPLFVNALGSHPRWGGETSGFVPYDAY
DERIPFCRPASLHPQPLSLGSAVMGDRLYNSDFDLHMRRNETCKTLCTTTISPNQTDFLQ
SLIRDYAHNWVVDGLPAAEMRADGAGRTLYSSGFPVGGYRTVLSPEAPEAAPRETFELYN
HFQIVIEYHPRPKEGASRIVGVLVWPQSIDSLKGGRLSSPDCDATGSFAVAAGDKARKVA
YTYDVYWRESATPWATRWDLYLRIVEPRIHVLALINSIVICLFLCLMVGMVLLRALNRDI
TKYNAVSSSAYDLDLDPADQIQDDSGWKLLHGEVFRPPKRRMWLCITVGTGAQISAMFGV
TLLFALLGFLSPSNRGALTTVMIICWTLFGFVAGYVSSRLYVTMNGDAIRKNIIYTALVF
PSVLFAFLHLLNFFLIGLRSAGAVPFGTFMAIGALWFGLHVPLTVVGGWIGVKRGPITNP
MRVNQIPRQIPTVDWWLKPIPSALIAGILPFGAGFIEINYLMQSLFGAKAYYAFGFLALT
SLVVALTTALTTVLFTYFHLCAEDYRWQWRSFVTGAASSVYVFAYGLLAWASRLHLPGFS
NKILFLGYLTFVAGLEAIVTGMVGFVATRAFLRVIYARIRID