Protein Info for mRNA_4763 in Rhodosporidium toruloides IFO0880

Name: 13131
Annotation: KOG1263 Multicopper oxidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00734: CBM_1" amino acids 33 to 60 (28 residues), 26.7 bits, see alignment (E = 9e-10) amino acids 76 to 104 (29 residues), 31.5 bits, see alignment (E = 2.8e-11) PF07732: Cu-oxidase_3" amino acids 206 to 313 (108 residues), 113.2 bits, see alignment E=1.5e-36 PF00394: Cu-oxidase" amino acids 327 to 470 (144 residues), 93 bits, see alignment E=4.5e-30 PF07731: Cu-oxidase_2" amino acids 586 to 692 (107 residues), 102.2 bits, see alignment E=4e-33

Best Hits

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (750 amino acids)

>mRNA_4763 KOG1263 Multicopper oxidases (Rhodosporidium toruloides IFO0880)
MAGALLAVPLGLQLSTSTSLVAASSAHHVAGYYEQCSGHGWHGATKCPSKWACAKQSDWF
SLCKPILDNHGCTNDEYAQCGGIGFKGEKCCKVGTSCKKDSDWWSACTPVKHTSKPHSST
SKPTSTKHSSTKPHSTSKPHSTSKSHTTTKAHSTSKPHSPTTTKPHHPTPPPRASVTSKL
DELRLSPDWNINAPPQKREYWWEVTEHPGALDGYDRPMLVVNGQYPGDTVVVHVTNSLDE
PVTIHWHGLFQNGTLWEDGPSGVTQCPIGPGITYTYDFPITGKEQYGTFWWHAHRRALYI
DGITGPFIIHSKNDPLKRGRDFDIDQIILLHDHYHRRSNEITDGLLSAGGFNGSFIAPSP
QSNVINGAGLYDCSFAAANATCRQKTQRDLPELRFPPNQRVRLRFINEGAHPLQFVSVDE
HELTVVEADFTPTMPLPVHRIPIAIAQRYSAILDTSGDETGDAFYLRAQINTGCLGLPFP
DLDPQARLVVRIGEDCDDLGQALPTSADWNDPATGNCTDLDAANLHPRIPRDAPSSASQV
LVFNSSFALPQNIFKWTLNDQTFENFAYDPLLQRVARGESIPTGRVAVVTAGHLEVVDLV
IQNIQGADHPFHLHGPQMYVLSRGPGLITPEQASRLRHNLTNPIRRDVITVSPGTWQVVR
LVADIPGVHAFHCHILWHQIQGLLGALIIEPDVIRTFQIPQDNLALCNGGNASVIDPGRK
RSLVRPALPAAPAFTGGFVKANKRESFWPW