Protein Info for mRNA_4774 in Rhodosporidium toruloides IFO0880

Name: 13142
Annotation: K02998 RP-SAe, RPSA small subunit ribosomal protein SAe

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR01012: ribosomal protein uS2" amino acids 14 to 208 (195 residues), 272.4 bits, see alignment E=1.8e-85 PF00318: Ribosomal_S2" amino acids 20 to 115 (96 residues), 39.7 bits, see alignment E=3.3e-14 amino acids 118 to 184 (67 residues), 60.5 bits, see alignment E=1.4e-20 PF16122: 40S_SA_C" amino acids 205 to 292 (88 residues), 40.2 bits, see alignment E=7.5e-14

Best Hits

Swiss-Prot: 78% identical to RSSA_POSPM: 40S ribosomal protein S0 (RPS0) from Postia placenta (strain ATCC 44394 / Madison 698-R)

KEGG orthology group: K02998, small subunit ribosomal protein SAe (inferred from 71% identity to scm:SCHCODRAFT_69443)

Predicted SEED Role

"SSU ribosomal protein SAe (S2p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>mRNA_4774 K02998 RP-SAe, RPSA small subunit ribosomal protein SAe (Rhodosporidium toruloides IFO0880)
MSSSRLPAALQATEEDISLLLQAQAHIGSKNVEKKMTPYVWKRRSDGVNIINVGKTWEKI
VFAARVIAAIENPNDVCVISARPYGHRAVLKFAANTGAQAIAGRFTPGNFTNYITRSFKE
PRLIVVTDPRVDHQAIREASYVNIPVIAICDTDSPLNYVDVAIPANNKSKHSIGLIWWLL
CREVLRLRGQISRASDAWPVMVDMFFYRDPEEIEREQEAAAAAKAAPADQEPAAEAGVSD
WEVTGSNAAIAAAASSQLPATEAGIDWSNTQESTDWAAEDSQVAASNQAGGWA