Protein Info for mRNA_4830 in Rhodosporidium toruloides IFO0880

Name: 13198
Annotation: K03066 PSMC5, RPT6 26S proteasome regulatory subunit T6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 TIGR01242: 26S proteasome subunit P45 family" amino acids 34 to 393 (360 residues), 445.1 bits, see alignment E=1e-137 PF16450: Prot_ATP_ID_OB" amino acids 74 to 129 (56 residues), 26.8 bits, see alignment 1.2e-09 PF07728: AAA_5" amino acids 186 to 256 (71 residues), 25.1 bits, see alignment E=4.9e-09 PF00004: AAA" amino acids 187 to 320 (134 residues), 148.1 bits, see alignment E=6.3e-47 PF07724: AAA_2" amino acids 187 to 297 (111 residues), 30.5 bits, see alignment E=1.2e-10 PF17862: AAA_lid_3" amino acids 344 to 386 (43 residues), 45.1 bits, see alignment 2.1e-15

Best Hits

Swiss-Prot: 81% identical to PRS8_SCHPO: 26S proteasome regulatory subunit 8 homolog (let1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K03066, 26S proteasome regulatory subunit T6 (inferred from 86% identity to scm:SCHCODRAFT_85835)

Predicted SEED Role

"proteasome regulatory subunit Rpt6" in subsystem Proteasome eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>mRNA_4830 K03066 PSMC5, RPT6 26S proteasome regulatory subunit T6 (Rhodosporidium toruloides IFO0880)
MPSLPSAIPHATAANGKAAGLTSYFSSKIEAAEQLIHTKSQDLRRLEAQRNALNARVRLL
REELQLLQEPGSYVGEVIKVMGKKKVLVKVQPEGKYVVDFASNIDVAQLTPNLRVALRSD
SYQLHSILPTKQDPLVALMMVEKVPDSTYEMVGGLDQQIKEIKEVIELPVKHPELFDALG
IAQPKGVLLYGPPGTGKTLLARAVAHHTDCRFIRVSGSELVQKYIGEGSRMVRELFVMAR
EHAPSIIFMDEIDSIGSSRGGSGGGGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRI
DILDPALLRPGRIDRKIEFPPPGPEARVSILRIHSRKMSLQRGINLRALAEKMGNCSGAE
VRGICTEAGMYALRERRQHVTQEDFELAVAKVLRKAGEGSMSSTKLFN