Protein Info for mRNA_4869 in Rhodosporidium toruloides IFO0880

Name: 13237
Annotation: K03364 CDH1 cell division cycle 20-like protein 1, cofactor of APC complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 PF12894: ANAPC4_WD40" amino acids 269 to 330 (62 residues), 26.7 bits, see alignment E=8.8e-10 PF00400: WD40" amino acids 355 to 388 (34 residues), 14.1 bits, see alignment (E = 1.1e-05) amino acids 395 to 435 (41 residues), 17.8 bits, see alignment 7.5e-07 amino acids 487 to 524 (38 residues), 23.3 bits, see alignment 1.3e-08

Best Hits

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>mRNA_4869 K03364 CDH1 cell division cycle 20-like protein 1, cofactor of APC complex (Rhodosporidium toruloides IFO0880)
MQSDFARRVRGGVATQGGGEGSGSGTASPVGSPRKPRPRESSFGSGGAYAGSGGSPSKKR
IYGDRFIPNRDGLDLATSFSLLPSSASSSGSGTPTSPSKSKRKAAGADGDAQTEEANRTF
DSLLRTELFGPSSLDPTPLLRSPSSVRATQYTAATSPNNSPSSSKPIFSFSSPTRKRVAR
DAADRGLDSPTHERYSLSPVRQESQRLLLSPRKPIRQVSKVPFKVLDAPELADDYYLNLV
DWSSTNVLGVGLGSAVYTWSAQTSEVKKLCDLSEFDPPDSITSLNWVQRGNQVAVGTKSG
MIQIWDANVGRCIRKMSGHSARVGALAWNDHILTSGSHDRLILHRDVRIKDHWTHKLAVH
RQEVCGLKWSDEGQLASGGNDNKLFVFDKILGPQTPLHRFTEHVAAVKAIAWNPHQHGVL
ASGGGTADQKLRFWNTMTGNLLQEVDTGSQVCNMLFSKTSNELVTTHGFSAGQAQNQVVI
WRYPSMQQVAQLTGHTFRVLYLASSPDGQTIVTGAGDETLRFWNAFPKSKVERKVDTSVL
SPFGRIR