Protein Info for mRNA_4874 in Rhodosporidium toruloides IFO0880

Name: 13242
Annotation: KOG2922 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details PF05653: Mg_trans_NIPA" amino acids 34 to 321 (288 residues), 274.1 bits, see alignment E=6.7e-86

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (711 amino acids)

>mRNA_4874 KOG2922 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MSTTTASLVASATSAAASASTSAAAHSQSGGNKVVGVLLAVGSGLLIGSSFVFKKKGLLS
AQRKANMAAGEGVPYLKSPLWWCGMIIMVVGELMNLIAYSFTDAILVTPMGSIAVVTSGA
LAHFFLGEKLTLFGWLGSTLCILGSVIIAVNGPSEEGSTTIQAFQSKFVSVGFLVWGGIC
IAAALGMIFFVAPRYGKRTMLVYITICSLLGGLSVACTSGLGGAILTSIKGDGSQWKHWF
MYFLLAFCVVTLLSEIVYLNKALALFNTASVTPVYFTIFTSCTLVTSIILNKGFGGASVA
AIITVVLGFLVIVVGISLLQLSKIDPEEIKEGMLDRRSTILLSASRAEKDTSSEKAFSVE
DPGMDAIRGAAGALGSIHRAISMRSGRGNQSRRTTGSSLANPFADEEMVMRRRGRNGAPG
AMGSGPHAVGEDGVLRYELYDQPMKFADEPMPLDAADKISLHSSLKSPSLEAGGRSRSAS
AIQFAETDEVHRYAPPKRKGKDPVAQHHEQPRLEGSHVHVPHTLSTGDIASPGLPPSRFS
SSTVATPDRADFSAARSGSVFANSSYVDPYNEEEHGRRSASPPLGSATYPRRQGTSDSGS
RSLAERLTSVFGASSPDLTSREFSQQPHDPPPSASRSRFALSPFRRNTPQDHEQELSSAK
DHRVPYPKAAKGDVEARGEEEALVPGRRRSGSVSSDEGGADLETVDTRDEL