Protein Info for mRNA_4914 in Rhodosporidium toruloides IFO0880

Name: 13282
Annotation: KOG0039 Ferric reductase, NADH/NADPH oxidase and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details PF01794: Ferric_reduct" amino acids 69 to 186 (118 residues), 64.6 bits, see alignment E=1.5e-21 PF08022: FAD_binding_8" amino acids 239 to 380 (142 residues), 67 bits, see alignment E=2.2e-22 PF08030: NAD_binding_6" amino acids 387 to 543 (157 residues), 93.5 bits, see alignment E=2.4e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>mRNA_4914 KOG0039 Ferric reductase, NADH/NADPH oxidase and related proteins (Rhodosporidium toruloides IFO0880)
MGALSRVKYELTGRRLLWNVFFYIGHILVFIYGWLKQARDARLAGLNTLKYSVWTSRGAG
LCLGVDGLILVLPVLRNAIRFVRPVFGRLIPLDENLWMHRQFAYSLLFWTIVHTTGHYVN
MYNVELTQIRKEVAWAILFTQPGGFTGHVMLVLMLLVYTTAHAKIRKQSFEAFWYTHHLV
ALILFCLYIHAVGCFVRGALPGQPVRCLGYYSWTWTIWGGIALLLERIVREIRSRRATKL
IAVLLHPQGALELRFVKPSFRYKSGQWLFLNVPAVSPFQWHPFTISSAPEDPYVSVHIRQ
VGDWTRALGQLLGCDSATVARLSTSYKSADLGEKAKLDSPPGYLEAVNDGSGDFHDVTSG
ALDAVGSLPTIRIDGPFGAPTQDVFRHEVAVLIGAGIGITPFASVLKTIWYKMQQNRLGA
LRRVQLVLVVRNTADMSWFHSLFRQLEESSTDPDFFTIRIYLTQPVSSAMLANIAIQSDE
VDAVSGLTSQTHFGRPDFDVFFRELRTKIDVGMYLPGQESSLTTDVGVFYCGPPGLAKEL
KSKAKKASSETVRFVFKKEHFVRLLHLSRFPPS