Protein Info for mRNA_4934 in Rhodosporidium toruloides IFO0880

Name: 13302
Annotation: K00611 OTC, argF, argI ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 44 to 378 (335 residues), 349 bits, E=1e-108
• PF02729: OTCace_N
  • amino acids 44 to 206 (163 residues), 156.5 bits, E=5.3e-50
• PF00185: OTCace
  • amino acids 220 to 375 (156 residues), 167.7 bits, E=2.2e-53

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• urea cycle (5/5 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• L-citrulline degradation (2/3 steps found)
• L-arginine biosynthesis IV (archaea) (6/9 steps found)
• L-arginine degradation V (arginine deiminase pathway) (2/4 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (383 amino acids)

>mRNA_4934 K00611 OTC, argF, argI ornithine carbamoyltransferase (Rhodosporidium toruloides IFO0880)
MLATQLVTVARKGCSCPVRIASRALSSAPVPTLPPSESGLRPPHLLTLADLTVPQIQSLI
SSAVAFKKHYKSRAIPKAGQIEGAKFEKGDGAVSSEVSEKTLDAKTVALMFSKRSTRTRV
ASETAIQLLGGHPMFLGSGDIQLGVNESLYDTTRVVSSMVDGIMARVGHHSEVETLAKYS
SVPVINALSHLYHPTQILADLQTLLEIRQPFTTDLSSLSGLTIAWVGDSNNILNEMMVTY
PRLGVNLQIATPKGYDLDAEVLKRANEGIKAEGGKGKIIHTHSPEEAVKNANVITTDTWI
SMGQEEEAAKRIKDFAGYQVTNDLLARGGAAKDAIFMHCLPRHKEEVDDEVFYGDESVVF
QEAENRKWTILAVFDAFIGRWKA