Protein Info for mRNA_4972 in Rhodosporidium toruloides IFO0880

Name: 13340
Annotation: KOG0085 G protein subunit Galphaq/Galphay, small G protein superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 253 to 272 (20 residues), see Phobius details PF00503: G-alpha" amino acids 16 to 345 (330 residues), 346.6 bits, see alignment E=1.8e-107 PF00025: Arf" amino acids 183 to 280 (98 residues), 33.6 bits, see alignment E=2.8e-12

Best Hits

KEGG orthology group: K04640, guanine nucleotide binding protein (G protein), alpha, other (inferred from 47% identity to cne:CNA01680)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>mRNA_4972 KOG0085 G protein subunit Galphaq/Galphay, small G protein superfamily (Rhodosporidium toruloides IFO0880)
MGCGASTPVDPEAQARSAAIEKTLAQDREKMRREMKLLFLGAGESGKSTIMKQFQLAYGR
PFTTEERDEYRDVIFDNAVRSMQVVIDAFDLLSIEIPESLNEHIELLMSIGDNPELSTDT
GELKPDVGNAIATVWAFDGAKEAVEMSHEFQLNDSASYYFDNIARLVQAGYVPSDLDILR
SRVKTTGITEIKLDIHGTIYRMMDVGGQRSERKKWINCFQDCQVLLFVLAISEYNQMLYE
DETVSRISEATTLWQSIANSKWFAMASIILFLNKIDIYRQKLELYKLSEYIPEYTGPNTY
EATTRFLAHRFSELYTNPTRPLIMHLTCATDTSQIRTVLAAVQEQILANNLLASGRM