Protein Info for mRNA_4990 in Rhodosporidium toruloides IFO0880

Name: 13358
Annotation: K00354 E1.6.99.1 NADPH2 dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00724: Oxidored_FMN" amino acids 10 to 346 (337 residues), 329.2 bits, see alignment E=1.7e-102

Best Hits

Swiss-Prot: 52% identical to FGOX3_PENRF: Chanoclavine-I aldehyde reductase fgaOx3 (fgaOx3) from Penicillium roqueforti (strain FM164)

KEGG orthology group: None (inferred from 59% identity to ssl:SS1G_01991)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>mRNA_4990 K00354 E1.6.99.1 NADPH2 dehydrogenase (Rhodosporidium toruloides IFO0880)
MPASAASSVLFQPIKVGRLELKQRLAMAPLTRFRADAQHVHQQPAVEYYGQRASAPGTLL
ITEATFVDPKAGGYPNVPGCYNQEQVAAWKKVVDEVHSKGSFIYLQLWALGRAADPENLK
KEFNADVVSASDVPFEGGAKPRPLSKEEIQDYVGYYARAAKLFVEEAGGDGVEIHNANGY
LLDQFLQTNSNKRTDEYGGSLENRARFPLEVAKAVSDAVGADRVGIRLSPYSTFQGMKMP
EIKDIKETFSYFVTELRQRHPDLAYIHAVESRIAGITTIDVDVAKEENLDFLHELWTPRP
FLIAGGFKPDTAVTAAEHYPNSVVVFGRYFISNPDLVRRIKEGIQLTEYNRETFYLYGPD
KTEGYTDYPFADEKKN