Protein Info for mRNA_5005 in Rhodosporidium toruloides IFO0880

Name: 13373
Annotation: K10956 SEC61A protein transport protein SEC61 subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 414 to 432 (19 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 30 to 463 (434 residues), 363.5 bits, see alignment E=7.1e-113 PF10559: Plug_translocon" amino acids 40 to 74 (35 residues), 67.4 bits, see alignment 7.6e-23 PF00344: SecY" amino acids 75 to 456 (382 residues), 242.4 bits, see alignment E=7.3e-76

Best Hits

Swiss-Prot: 74% identical to SC61A_NEUCR: Protein transport protein SEC61 subunit alpha (sec-61) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K10956, protein transport protein SEC61 subunit alpha (inferred from 81% identity to lbc:LACBIDRAFT_312758)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>mRNA_5005 K10956 SEC61A protein transport protein SEC61 subunit alpha (Rhodosporidium toruloides IFO0880)
MSFRALDLVRPFLPILPEVSAPDRKIPFNTKVGWTAITLLIFLVCSQIPLYGIVSSDSSD
PLYWMRVILASNRGTLMELGITPIITSGMIIQLLQGAGFIEVDFTLKEDRALFGGAQKLL
ALLISFGQATVYVLTGLYGQPSDLGAGVCLLLILQLIVAALIVILLDELLQKGYGLGSGI
NLFIATNICESIVWKAFSPTTVNTGRGPEFEGALIALFHLLFTWNDKSRALKEAFYRERL
PNVMNLVATVAVFALVIYLQGFRIEIPVRSSRVQGQRGTYPVKLFYTSNMPIMLESALTS
NVFIVSQMLFNRFPENFLVRLIGVWEPLEDSAQLFAKSGLAYYMSPPRALREVLTDPIHT
AIYIAFMLSACALFSKTWIEISGSSPRDVAKQLKDQGMVLAGRRDDSMYKELKRIIPTAA
VFGGAVIGLLSVTADLVGALGSGTGILLCVTIIYSYFEMAVKESTPGMEALGDLF