Protein Info for mRNA_5061 in Rhodosporidium toruloides IFO0880

Name: 13429
Annotation: K11414 SIRT4, SIR2L4 NAD-dependent deacetylase sirtuin 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 26 to 112 (87 residues), 53.5 bits, E=1.5e-18
  • amino acids 140 to 258 (119 residues), 53.1 bits, E=2e-18

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

Protein Sequence (343 amino acids)

>mRNA_5061 K11414 SIRT4, SIR2L4 NAD-dependent deacetylase sirtuin 4 (Rhodosporidium toruloides IFO0880)
MSLADSVQLLVDFLRKGKGNTTLLTGAGISVDSGIRAYRGPGGTYTIRKHRPIFYGEFIQ
DEAMRRRFLGYPPVRRAESNPTHYAMAALQKMGYLSSLITQNVDGLHHRAYSDDLSLYLS
PPSVKPTEAPDAPLPPLDPAILELHGTLRHAHCLSCHTPVGRDSFQDRLSELNPAWHEFQ
KEVELGKREEKLNPDGDIELGPGVRYEDFQVPACDQCGGPMKPRVIFFGESLEPLTRRHS
EHFVSSASQLLVAGSSLATFSAYRLVRQMKEQGGPVGLINVGESRADPIVDWRVGWEGGA
GDIFPEAVRELLKDEKRPDVKAEVERMLKAGKVRKVPPGPAAS