Protein Info for mRNA_5068 in Rhodosporidium toruloides IFO0880

Name: 13436
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 169 to 188 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details amino acids 331 to 355 (25 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details amino acids 484 to 504 (21 residues), see Phobius details amino acids 516 to 537 (22 residues), see Phobius details amino acids 549 to 571 (23 residues), see Phobius details amino acids 581 to 600 (20 residues), see Phobius details PF07690: MFS_1" amino acids 175 to 549 (375 residues), 98.4 bits, see alignment E=2.2e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (613 amino acids)

>mRNA_5068 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MPDMIRDSPFGLFMHAVSRGKLFRHPEEQPGYVVPSKYLRHSGDDSDRSSSRSSDSTLAN
PNRPSVDAATLVGADQPVKRKSPTEQEKRDRDEWTGEKRQQRERDLEAADDENEEEQQRR
QKERDNHPGTADPERAHKEGLIDKYQYLVDFEENDPGNPLNWSPWKKHFAAFQIAMMTTV
VYIGSAIYTPSEQNLGEVYGVSETVTVLGLTLFILGYGTGPMFFSPLQETPHLGRNPAYW
AALFLFVLLQIPILLPTNLTCIFIFRFLTGFFGSPILATGGASMGDLYVPRQLPYAMGGW
AVGAVLGPIMGPVVAAFAVQANGWKWSILELVWMSGFGLLFFTFLLPETYAPTILLRRAE
RLRKLTGNELLKTRWELENPHGVSLFKVGAKQIGLAFRLAVEPAIGYANLYIGLIYAVFY
LWFEAFPIVFAEYHGFNLGLSVLPFLGFLVTGALTLLGYCLYHKYYFIPKQDREDWKTPP
EQRLKLALIATPMIPISLFIFGWTGNSPSTHWIGPTIGAALYFPGVFCAFQCILLYLQQG
YPSVTASILAGNDLFRSCMAAGFPLFGRAFFTNLGVGPASSLLAGLNIVFIIPLWGLYLY
GDRLRKRSKFGTS