Protein Info for mRNA_5087 in Rhodosporidium toruloides IFO0880

Name: 13455
Annotation: K06890 K06890 uncharacterized protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 84 to 103 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details PF01027: Bax1-I" amino acids 78 to 279 (202 residues), 144.8 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 37% identical to LFG4_MOUSE: Protein lifeguard 4 (Tmbim4) from Mus musculus

KEGG orthology group: K06890, (no description) (inferred from 50% identity to cci:CC1G_03263)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>mRNA_5087 K06890 K06890 uncharacterized protein (Rhodosporidium toruloides IFO0880)
MSASSSYPVPPPSYSSSPSSSKKPAYGATAGSSDQGVSEPLLAGEGEAARDAWSEEDELE
GDFKIGVTVSQSSQDVRNDFVKKVYSVLFLQILGTTLIGWLMSSSPSIVSWTREHSGLML
LPSLGAIGAMIGVYFKRHSSPANILLLGLFTVLEAITLGSVVSYFNQAVVLQALVITTFV
FLGLTLFTLQSKYDFSSMGTYLYTFLLVFFFTGLVGIFIPYNRTFDMLMAGAGCLLFSAY
IVFDTHMLFQRLHVDDWVVACVALYLDIVNLFLQILRLLSDVQER