Protein Info for mRNA_5094 in Rhodosporidium toruloides IFO0880

Name: 13462
Annotation: K10259 MET30 F-box and WD-40 domain protein MET30

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 PF00646: F-box" amino acids 215 to 257 (43 residues), 30.2 bits, see alignment 8.2e-11 PF12937: F-box-like" amino acids 216 to 257 (42 residues), 46.7 bits, see alignment 5.8e-16 PF00400: WD40" amino acids 419 to 457 (39 residues), 30.2 bits, see alignment 1.5e-10 amino acids 461 to 497 (37 residues), 22.1 bits, see alignment (E = 5.5e-08) amino acids 501 to 537 (37 residues), 31.6 bits, see alignment (E = 5.6e-11) amino acids 543 to 614 (72 residues), 18.4 bits, see alignment E=8e-07 amino acids 747 to 783 (37 residues), 21.9 bits, see alignment (E = 6.2e-08) amino acids 787 to 823 (37 residues), 23.2 bits, see alignment (E = 2.4e-08)

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (828 amino acids)

>mRNA_5094 K10259 MET30 F-box and WD-40 domain protein MET30 (Rhodosporidium toruloides IFO0880)
MASPSAPFMSAVDPFHFEPQSPPTTSTSLANGLPPFPFTSAPAPLPASQSRVSPALYSPH
SAASTASIAQSIAPSLGPRSPFPAHEAENMEGILTGEPKGAGGAVTEAMSRMEVEDELRR
GPPTSDTPGGDCRNVCIRHARMANGATNLMLQKSLENLAPHEQQAVNTIWSLFSSSPSKR
RLLILRGLLTIACPSQLSFLQEALALEMRLDPVELLPREVTLKIFGYLDAISLGRAAQVS
RAWKGMADDDLLWRTMCEQHIERKCEKCGWGLPLLGERRRKARLAMNSLPASRAGEVSRG
RDSDVRRMLEDTATSAAQAQAEHQHLHHHDDSGAPSSAMVIEPGSAASSDSHRHKRSKTS
SPTPSRPASPRPPSSRPSLLPASADSAPVVPLTRPWKHVYCERLAIERNWRRGTCAATVL
SGHTDSITCLQVAEDLPHPNFPVLMTGSWDRSVRIWNLETGKEVGVLRGHTRGVRALQFD
ALKLVTGSMDSTLKIWNWRTGECMRTLRGHRDAVLCLTYDKQLLVSGSGDSTIRVWDFGT
GEVYTLRGHTEWVNSVALWDSKTNGCEPSPSTIGGPASAADLGAPISNPEQAKQSSMGKY
LFSASDDATIRVWDLYTRSCVRVLSGHVAQVQSLKVYVVGPGEGQGSAAFPDSLLQPPAT
TPGEDEPLEGANSALSTARPNCTANQRLPPAPPASLLNPAVFTGQTARPLFPNAPAQPDF
EFPSDKKPMVVSASLDNTVRVWNVESGQCVRQQFGHLEGVWSVDVDKLRIVSCSHDRTIK
IWDRDSGKNLHTIVGHKAAVTSVLLTDQSVISGSDDGEVRVWSFAPRD