Protein Info for mRNA_5095 in Rhodosporidium toruloides IFO0880

Name: 13463
Annotation: K03106 SRP54, ffh signal recognition particle subunit SRP54

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 PF02881: SRP54_N" amino acids 6 to 95 (90 residues), 66.2 bits, see alignment E=8.7e-22 PF03308: MeaB" amino acids 111 to 158 (48 residues), 23.9 bits, see alignment 6.9e-09 PF00448: SRP54" amino acids 117 to 311 (195 residues), 255.6 bits, see alignment E=1e-79 PF02492: cobW" amino acids 118 to 267 (150 residues), 27.6 bits, see alignment E=7.5e-10 PF13671: AAA_33" amino acids 118 to 223 (106 residues), 28.9 bits, see alignment E=4.3e-10 PF02978: SRP_SPB" amino acids 388 to 499 (112 residues), 88.9 bits, see alignment E=1e-28

Best Hits

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (612 amino acids)

>mRNA_5095 K03106 SRP54, ffh signal recognition particle subunit SRP54 (Rhodosporidium toruloides IFO0880)
MVLQDLGKRLNTAINSLTQQSAIDEQALDAVLKSVCAALLESDVNVLLVKRLRDKVKGKV
LPQLEEIQAKQGQDADAMQGNKAKQIIQKAIYDELVALVDPGDAAPPAFNPVKGKTQVIM
MVGLQGAGKTTTCTKLATHYQRRGLKVALVCADTFRAGAFDQLKQNATKAKVPFFGSYTE
TDPVSISLQGVTKFRSERFDVIIVDTSGRHRQESELFDEMRQIQDAVEPNMVVLVLDGAI
GQAAEAQSRAFKEASNFGAIIVTKLDGHAKGGGAISAVAATNTPIIFIGTGEHLHDLEKF
SPQPFISKMLGMGDMQGLVERAQEMALANPERQEKMMKKLEKGEFTVRDLKDQLATVMGM
CVAGSFLRSSRSTAFELLTGKCRAYAYRGPLSNLASMIPGMSEMMGGGGEEDVSRRMKRV
AFIFDSMTTEELDSDGSLFRDSVPSAKGKEKEKDEEKDPSNPMGLREPNKRVLRVARGSG
TSVQEVEELLAQHQMFAKMAKRMGGKNGLMGKLAARGGAGGRPGGMPGLGGAGMPPLGPG
GMPDLSKLSPSQMRAMQSMLPPGAREMMSRPGAMEEMQKMMSGAGGLGGLGNLMGGMGGG
MGDMLKGMMGGR