Protein Info for mRNA_5109 in Rhodosporidium toruloides IFO0880

Name: 13477
Annotation: K17605 PPP2R4, PTPA serine/threonine-protein phosphatase 2A activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF03095: PTPA" amino acids 12 to 303 (292 residues), 393.7 bits, see alignment E=3.4e-122

Best Hits

Swiss-Prot: 64% identical to PTPA2_CRYNJ: Serine/threonine-protein phosphatase 2A activator 2 (RRD2) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 60% identity to lbc:LACBIDRAFT_191878)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>mRNA_5109 K17605 PPP2R4, PTPA serine/threonine-protein phosphatase 2A activator (Rhodosporidium toruloides IFO0880)
MATDAPTGPIVPTKRVVSKAHLEAWLKSGTHDEVVAFVEQLNEAAVGVKLTDEVPTSQAV
EAVLAVLEEVEGIYNATPPVDNGNSRFGNPAFRDYYDKVASRAAELHSRIPGLDSAYTTE
LSVYFCESWGNRTRIDYGSGMELNFLCWLLCLQKLGVLKKEDNTAVVIKVFWKYMRIARL
LQAGYWLEPAGSHGAQGLDDYHFAVFIFGSAQLRTHKYLRPKAIHDDEILEEFSKDYMYL
SYIRYINSIKTASLRWHSPMLDDISGVKTWEKVNSGMLKMYRAEVLAKLPVVQHFLFGSL
LPWPPTPELETHREEPDVHVDSTGLLHVRGEGFGDCCNIPIPSAIAASQMAQNGGKGGAG
GLGSNPAVRRIPFD