Protein Info for mRNA_5124 in Rhodosporidium toruloides IFO0880

Name: 13492
Annotation: K13248 PHOSPHO2 pyridoxal phosphate phosphatase PHOSPHO2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR01489: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase" amino acids 8 to 207 (200 residues), 102.5 bits, see alignment E=3e-33 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 9 to 198 (190 residues), 64.3 bits, see alignment E=1.4e-21 PF06888: Put_Phosphatase" amino acids 9 to 248 (240 residues), 163.2 bits, see alignment E=7.1e-52 PF12710: HAD" amino acids 73 to 195 (123 residues), 31.8 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: K13248, pyridoxal phosphate phosphatase PHOSPHO2 [EC: 3.1.3.74] (inferred from 56% identity to lbc:LACBIDRAFT_183528)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>mRNA_5124 K13248 PHOSPHO2 pyridoxal phosphate phosphatase PHOSPHO2 (Rhodosporidium toruloides IFO0880)
MSASPRRVLVCSDFDWSWADQDTDRYVFEVLAPHLRTSLRASKKTHQWTDNCAEHLRKLH
AEGFGKEDVLGALRQVPVHPAMRRAFVDLKASKDPQVTTFILSNANSVYIDTILKHYGVE
NAIDEVVTNPAQFRDDGLLELRRRVDPNGPQHQCKVGCSPNMCKGEELEAFMARNGGWES
FDKVIYIGDGANDLCPILHLRSQDVALVRLYRELYRRLQDSTAAHTSDVKCKVVSWGGAW
EVEKWLKEEL